Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188265] (3 PDB entries) |
Domain d2yzhb1: 2yzh B:1-168 [170941] Other proteins in same PDB: d2yzha2, d2yzhb2, d2yzhc2, d2yzhd2 automated match to d1psqa_ complexed with so4 |
PDB Entry: 2yzh (more details), 1.85 Å
SCOPe Domain Sequences for d2yzhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yzhb1 c.47.1.0 (B:1-168) automated matches {Aquifex aeolicus [TaxId: 224324]} martvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldtpv cetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekygvl igegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkel
Timeline for d2yzhb1: