SCOP 1.73: Domain d1weta1: 1wet A:3-58

Lineage for d1weta1 (1wet A:3-58)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d1weta1: 1wet A:3-58 [17093]
   Other proteins in same PDB: d1weta2
   protein/DNA complex; complexed with gun

Details for d1weta1

PDB Entry: 1wet, 2.6 Å

PDB Description: structure of the purr-guanine-purf operator complex

PDB Compounds: (A:) protein (purine repressor)

SCOP Domain Sequences for d1weta1:

Sequence; same for both SEQRES and ATOM records:

>d1weta1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d1weta1:

• d1weta1 first appeared (with stable ids) in SCOP 1.55
  
• d1weta1 appears in SCOP 1.71
  
• d1weta1 appears in SCOP 1.75
  
• d1weta1 appears in the current release, SCOPe 2.08