Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Mycoplasma pneumoniae [TaxId:272634] [188426] (1 PDB entry) |
Domain d2yy5d_: 2yy5 D: [170926] automated match to d1i6ka_ complexed with so4, wsa |
PDB Entry: 2yy5 (more details), 2.55 Å
SCOPe Domain Sequences for d2yy5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yy5d_ c.26.1.0 (D:) automated matches {Mycoplasma pneumoniae [TaxId: 272634]} mmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnf dlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtrnp ngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlp qfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfas ktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvni qrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
Timeline for d2yy5d_: