Lineage for d2yxeb_ (2yxe B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379620Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1379621Protein automated matches [190689] (42 species)
    not a true protein
  7. 1379768Species Methanocaldococcus jannaschii [TaxId:243232] [188256] (2 PDB entries)
  8. 1379770Domain d2yxeb_: 2yxe B: [170908]
    automated match to d1jg1a_
    complexed with act

Details for d2yxeb_

PDB Entry: 2yxe (more details), 2 Å

PDB Description: Crystal structure of L-isoaspartyl protein carboxyl methyltranferase
PDB Compounds: (B:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d2yxeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxeb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
dleeqkkaviekliregyikskrvidallkvpreeflpehlkeyayvdtpleigygqtis
aihmvgmmcelldlkpgmkvleigtgcgyhaavtaeivgedglvvsieripelaekaert
lrklgydnvivivgdgtlgyeplapydriyttaagpkipeplirqlkdggkllmpvgryl
qrlvlaekrgdeiiikdcgpvafvplvgkegfq

SCOPe Domain Coordinates for d2yxeb_:

Click to download the PDB-style file with coordinates for d2yxeb_.
(The format of our PDB-style files is described here.)

Timeline for d2yxeb_: