Lineage for d2yxdb_ (2yxd B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176809Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1176810Protein automated matches [190689] (23 species)
    not a true protein
  7. 1176870Species Methanocaldococcus jannaschii [TaxId:243232] [188256] (2 PDB entries)
  8. 1176874Domain d2yxdb_: 2yxd B: [170906]
    automated match to d1f38a_
    complexed with mes, so4

Details for d2yxdb_

PDB Entry: 2yxd (more details), 2.3 Å

PDB Description: Crystal Structure of Cobalamin biosynthesis precorrin 8W decarboxylase (cbiT)
PDB Compounds: (B:) Probable cobalt-precorrin-6Y C(15)-methyltransferase [decarboxylating]

SCOPe Domain Sequences for d2yxdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxdb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mipdeefirregvpitkeeiravsigklnlnkddvvvdvgcgsggmtveiakrckfvyai
dyldgaievtkqnlakfnikncqiikgraedvldklefnkafiggtkniekiieildkkk
inhivantivlenaakiinefesrgynvdavnvfisyakkipsghmflaknpitiikavr

SCOPe Domain Coordinates for d2yxdb_:

Click to download the PDB-style file with coordinates for d2yxdb_.
(The format of our PDB-style files is described here.)

Timeline for d2yxdb_: