Lineage for d2ywya_ (2ywy A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931866Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (5 PDB entries)
  8. 931872Domain d2ywya_: 2ywy A: [170894]
    automated match to d1vesa_

Details for d2ywya_

PDB Entry: 2ywy (more details), 2.71 Å

PDB Description: Structure of new antigen receptor variable domain from sharks
PDB Compounds: (A:) new antigen receptor variable domain

SCOPe Domain Sequences for d2ywya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywya_ b.1.1.1 (A:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprsvtketgesltincalknaaddlertdwyrttlgstneqkisiggryvetvn
kgsksfslrirdlrvedsgtykcgayfsdamsnysypipgekgagtvltvkaa

SCOPe Domain Coordinates for d2ywya_:

Click to download the PDB-style file with coordinates for d2ywya_.
(The format of our PDB-style files is described here.)

Timeline for d2ywya_: