SCOPe 2.01: Domain d2ywka_: 2ywk A:

Lineage for d2ywka_ (2ywk A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (4 PDB entries)

8. Domain d2ywka_: 2ywk A: [170890]
   automated match to d1x5ua1

Details for d2ywka_

PDB Entry: 2ywk, 1.54 Å

PDB Description: crystal structure of rrm-domain derived from human putative rna- binding protein 11

PDB Compounds: (A:) Putative RNA-binding protein 11

SCOPe Domain Sequences for d2ywka_:

Sequence; same for both SEQRES and ATOM records:

>d2ywka_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfgfvcfkhpesvs
yaiallngirlygrpinvsgpssg

Timeline for d2ywka_:

• d2ywka_ is new in SCOPe 2.01-stable
  
• d2ywka_ appears in SCOPe 2.02
  
• d2ywka_ appears in the current release, SCOPe 2.08, called d2ywka1