Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188415] (4 PDB entries) |
Domain d2yvld_: 2yvl D: [170887] automated match to d1o54a_ complexed with sam |
PDB Entry: 2yvl (more details), 2.2 Å
SCOPe Domain Sequences for d2yvld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvld_ c.66.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]} nsfkegeyvlirfgekkflrkllpkqslsvkksvlkfdevigkpegvkingfevyrptle eiillgferktqiiypkdsfyialklnlnkekrvlefgtgsgallavlsevagevwtfea veefyktaqknlkkfnlgknvkffnvdfkdaevpegifhaafvdvrepwhylekvhkslm egapvgfllptanqvikllesienyfgnlevveilhrhyktiserfrpedqmvahtaylv fgrklkt
Timeline for d2yvld_: