Lineage for d2yvld_ (2yvl D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894496Species Aquifex aeolicus [TaxId:224324] [188415] (4 PDB entries)
  8. 2894502Domain d2yvld_: 2yvl D: [170887]
    automated match to d1o54a_
    complexed with sam

Details for d2yvld_

PDB Entry: 2yvl (more details), 2.2 Å

PDB Description: Crystal structure of tRNA (m1A58) methyltransferase TrmI from Aquifex aeolicus
PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2yvld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvld_ c.66.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]}
nsfkegeyvlirfgekkflrkllpkqslsvkksvlkfdevigkpegvkingfevyrptle
eiillgferktqiiypkdsfyialklnlnkekrvlefgtgsgallavlsevagevwtfea
veefyktaqknlkkfnlgknvkffnvdfkdaevpegifhaafvdvrepwhylekvhkslm
egapvgfllptanqvikllesienyfgnlevveilhrhyktiserfrpedqmvahtaylv
fgrklkt

SCOPe Domain Coordinates for d2yvld_:

Click to download the PDB-style file with coordinates for d2yvld_.
(The format of our PDB-style files is described here.)

Timeline for d2yvld_: