Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (232 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d2yrsm_: 2yrs M: [170878] Other proteins in same PDB: d2yrsb_, d2yrsd_, d2yrsk_, d2yrso_ automated match to d1a00a_ complexed with hem |
PDB Entry: 2yrs (more details), 2.3 Å
SCOPe Domain Sequences for d2yrsm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrsm_ a.1.1.2 (M:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d2yrsm_: