Lineage for d2yrsk_ (2yrs K:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302148Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)
  8. 2302157Domain d2yrsk_: 2yrs K: [170877]
    Other proteins in same PDB: d2yrsa_, d2yrsc_, d2yrsi_, d2yrsm_
    automated match to d1dxtb_
    complexed with hem

Details for d2yrsk_

PDB Entry: 2yrs (more details), 2.3 Å

PDB Description: Human hemoglobin D Los Angeles: crystal structure
PDB Compounds: (K:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2yrsk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrsk_ a.1.1.2 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
qftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2yrsk_:

Click to download the PDB-style file with coordinates for d2yrsk_.
(The format of our PDB-style files is described here.)

Timeline for d2yrsk_: