Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188371] (5 PDB entries) |
Domain d2yrsd_: 2yrs D: [170875] Other proteins in same PDB: d2yrsa_, d2yrsc_, d2yrsi_, d2yrsm_ automated match to d1dxtb_ complexed with hem |
PDB Entry: 2yrs (more details), 2.3 Å
SCOPe Domain Sequences for d2yrsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrsd_ a.1.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk qftppvqaayqkvvagvanalahkyh
Timeline for d2yrsd_: