Lineage for d1vpwa1 (1vpw A:3-58)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537367Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 537398Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 537399Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 537400Domain d1vpwa1: 1vpw A:3-58 [17087]
    Other proteins in same PDB: d1vpwa2
    protein/DNA complex; complexed with hpa; mutant

Details for d1vpwa1

PDB Entry: 1vpw (more details), 2.7 Å

PDB Description: structure of the purr mutant, l54m, bound to hypoxanthine and purf operator dna

SCOP Domain Sequences for d1vpwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpwa1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarsmkvnh

SCOP Domain Coordinates for d1vpwa1:

Click to download the PDB-style file with coordinates for d1vpwa1.
(The format of our PDB-style files is described here.)

Timeline for d1vpwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpwa2