SCOP 1.55: Domain d1vpwa1: 1vpw A:3-58

Lineage for d1vpwa1 (1vpw A:3-58)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.5: Bacterial repressors [47438] (3 proteins)

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (21 PDB entries)

8. Domain d1vpwa1: 1vpw A:3-58 [17087]
   Other proteins in same PDB: d1vpwa2

Details for d1vpwa1

PDB Entry: 1vpw, 2.7 Å

PDB Description: structure of the purr mutant, l54m, bound to hypoxanthine and purf operator dna

SCOP Domain Sequences for d1vpwa1:

Sequence; same for both SEQRES and ATOM records:

>d1vpwa1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarsmkvnh

Timeline for d1vpwa1:

• d1vpwa1 appears in SCOP 1.57
  
• d1vpwa1 appears in the current release, SCOPe 2.08