Lineage for d2puba1 (2pub A:3-58)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768184Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 768224Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 768225Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 768229Domain d2puba1: 2pub A:3-58 [17086]
    Other proteins in same PDB: d2puba2
    protein/DNA complex; complexed with ad2; mutant

Details for d2puba1

PDB Entry: 2pub (more details), 2.7 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
PDB Compounds: (A:) purine repressor

SCOP Domain Sequences for d2puba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2puba1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

SCOP Domain Coordinates for d2puba1:

Click to download the PDB-style file with coordinates for d2puba1.
(The format of our PDB-style files is described here.)

Timeline for d2puba1: