SCOP 1.71: Domain d2puba1: 2pub A:3-58

Lineage for d2puba1 (2pub A:3-58)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d2puba1: 2pub A:3-58 [17086]
   Other proteins in same PDB: d2puba2
   protein/DNA complex; complexed with ad2; mutant

Details for d2puba1

PDB Entry: 2pub, 2.7 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

SCOP Domain Sequences for d2puba1:

Sequence; same for both SEQRES and ATOM records:

>d2puba1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d2puba1:

• d2puba1 first appeared (with stable ids) in SCOP 1.55
  
• d2puba1 appears in SCOP 1.69
  
• d2puba1 appears in SCOP 1.73
  
• d2puba1 appears in the current release, SCOPe 2.08