Lineage for d2yk3b_ (2yk3 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1981148Protein automated matches [190113] (17 species)
    not a true protein
  7. 1981151Species Crithidia fasciculata [TaxId:5656] [189994] (2 PDB entries)
  8. 1981153Domain d2yk3b_: 2yk3 B: [170832]
    automated match to d1hroa_
    complexed with hem, so4

Details for d2yk3b_

PDB Entry: 2yk3 (more details), 1.55 Å

PDB Description: crithidia fasciculata cytochrome c
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d2yk3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yk3b_ a.3.1.1 (B:) automated matches {Crithidia fasciculata [TaxId: 5656]}
araplppgdaargeklfkgraaqchtanqggangvgpnlyglvgrhsgtiegyayskana
esgvvwtpdvldvylenpkkfmpgtkmsfagmkkpqeradviayletlkg

SCOPe Domain Coordinates for d2yk3b_:

Click to download the PDB-style file with coordinates for d2yk3b_.
(The format of our PDB-style files is described here.)

Timeline for d2yk3b_: