Lineage for d2yjwa_ (2yjw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039421Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1039422Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1039423Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1039424Protein HSP90 [55876] (3 species)
  7. 1039492Species Human (Homo sapiens) [TaxId:9606] [55878] (53 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 1039503Domain d2yjwa_: 2yjw A: [170826]
    automated match to d1uyia_
    complexed with yjw

Details for d2yjwa_

PDB Entry: 2yjw (more details), 1.61 Å

PDB Description: tricyclic series of hsp90 inhibitors
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d2yjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjwa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
metfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d2yjwa_:

Click to download the PDB-style file with coordinates for d2yjwa_.
(The format of our PDB-style files is described here.)

Timeline for d2yjwa_: