SCOPe 2.01: Domain d2yinc_: 2yin C:

Lineage for d2yinc_ (2yin C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (67 PDB entries)

8. Domain d2yinc_: 2yin C: [170809]
   automated match to d1foeb_

Details for d2yinc_

PDB Entry: 2yin, 2.7 Å

PDB Description: structure of the complex between dock2 and rac1.

PDB Compounds: (C:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d2yinc_:

Sequence; same for both SEQRES and ATOM records:

>d2yinc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgtmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwd
tagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkl
dlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl

Timeline for d2yinc_:

• d2yinc_ is new in SCOPe 2.01-stable
  
• d2yinc_ appears in SCOPe 2.02
  
• d2yinc_ appears in the current release, SCOPe 2.08, called d2yinc1