Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Collagenase-3 (MMP-13) [55540] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55541] (47 PDB entries) |
Domain d2yigb_: 2yig B: [170804] automated match to d1euba_ complexed with 5el, ca, na, zn |
PDB Entry: 2yig (more details), 1.7 Å
SCOPe Domain Sequences for d2yigb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yigb_ d.92.1.11 (B:) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaahe fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpg
Timeline for d2yigb_: