Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (17 PDB entries) |
Domain d2yggb_: 2ygg B: [170785] automated match to d1cfca_ complexed with ca, mpd, mrd, tam |
PDB Entry: 2ygg (more details), 2.23 Å
SCOPe Domain Sequences for d2yggb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yggb_ a.39.1.5 (B:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti dfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevde mireadidgdgqvnyeefvqmmtaka
Timeline for d2yggb_: