Lineage for d2ygaa_ (2yga A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973543Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187543] (7 PDB entries)
  8. 2973550Domain d2ygaa_: 2yga A: [170782]
    automated match to d1ah8b_
    complexed with gdm; mutant

Details for d2ygaa_

PDB Entry: 2yga (more details), 2.37 Å

PDB Description: E88G-N92L Mutant of N-Term HSP90 complexed with Geldanamycin
PDB Compounds: (A:) ATP-dependent molecular chaperone hsp82

SCOPe Domain Sequences for d2ygaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ygaa_ d.122.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletep
dlfiritpkpeqkvleirdsgigmtkaglinllgtiaksgtkafmealsagadvsmigqf
gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
qleyleekrikevikrhsefvaypiqlvvtkeve

SCOPe Domain Coordinates for d2ygaa_:

Click to download the PDB-style file with coordinates for d2ygaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ygaa_: