Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein Scorpion toxin [57097] (17 species) |
Species Mexican scorpion (Centruroides noxius), toxin II [TaxId:6878] [57103] (4 PDB entries) |
Domain d2yc1f_: 2yc1 F: [170735] Other proteins in same PDB: d2yc1a_, d2yc1b_, d2yc1d_, d2yc1e_ automated match to d1cn2a_ complexed with gol |
PDB Entry: 2yc1 (more details), 1.9 Å
SCOPe Domain Sequences for d2yc1f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yc1f_ g.3.7.1 (F:) Scorpion toxin {Mexican scorpion (Centruroides noxius), toxin II [TaxId: 6878]} kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl pnkrc
Timeline for d2yc1f_: