Lineage for d2ybrc_ (2ybr C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257552Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2257553Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2257569Protein Scorpion toxin [57097] (17 species)
  7. 2257616Species Mexican scorpion (Centruroides noxius), toxin II [TaxId:6878] [57103] (4 PDB entries)
  8. 2257619Domain d2ybrc_: 2ybr C: [170728]
    Other proteins in same PDB: d2ybra_, d2ybrb_, d2ybrd_, d2ybre_, d2ybrg_, d2ybrh_
    automated match to d1cn2a_

Details for d2ybrc_

PDB Entry: 2ybr (more details), 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (C:) beta-mammal toxin cn2

SCOPe Domain Sequences for d2ybrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybrc_ g.3.7.1 (C:) Scorpion toxin {Mexican scorpion (Centruroides noxius), toxin II [TaxId: 6878]}
kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
pnkrc

SCOPe Domain Coordinates for d2ybrc_:

Click to download the PDB-style file with coordinates for d2ybrc_.
(The format of our PDB-style files is described here.)

Timeline for d2ybrc_: