| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
Superfamily d.353.1: AMPKBI-like [160219] (1 family) ![]() |
| Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
| Protein automated matches [190789] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188044] (5 PDB entries) |
| Domain d2ya3b_: 2ya3 B: [170706] Other proteins in same PDB: d2ya3a_ automated match to d2v8qb1 complexed with amp, j7v |
PDB Entry: 2ya3 (more details), 2.5 Å
SCOPe Domain Sequences for d2ya3b_:
Sequence, based on SEQRES records: (download)
>d2ya3b_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi
>d2ya3b_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkhvmlnhlyalsikdsvmvlsathrykkkyv
ttllykpi
Timeline for d2ya3b_: