Lineage for d2y8fd_ (2y8f D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799190Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 1799211Protein automated matches [191227] (1 species)
    not a true protein
  7. 1799212Species Human (Homo sapiens) [TaxId:9606] [189645] (2 PDB entries)
  8. 1799218Domain d2y8fd_: 2y8f D: [170694]
    automated match to d2crfa1
    complexed with cl, gol

Details for d2y8fd_

PDB Entry: 2y8f (more details), 2.1 Å

PDB Description: structure of the ran-binding domain from human ranbp3 (wild type)
PDB Compounds: (D:) ran-binding protein 3

SCOPe Domain Sequences for d2y8fd_:

Sequence, based on SEQRES records: (download)

>d2y8fd_ b.55.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamkvevitgeeaesnvlqmqcklfvfdktsqswvergrgllrlndmastddgtlqsrlv
mrtqgslrlilntklwaqmqidkaseksiritamdtedqgvkvflisasskdtgqlyaal
hhrilalrsrveqeqeak

Sequence, based on observed residues (ATOM records): (download)

>d2y8fd_ b.55.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamkvevitgeeaesnvlqmqcklfvfdktsqswvergrgllrlndmatlqsrlvmrtqg
slrlilntklwaqmqidkaseksiritamdtedqgvkvflisasskdtgqlyaalhhril
alrsrveqeqeak

SCOPe Domain Coordinates for d2y8fd_:

Click to download the PDB-style file with coordinates for d2y8fd_.
(The format of our PDB-style files is described here.)

Timeline for d2y8fd_: