Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.3: Ran-binding domain [50764] (5 proteins) |
Protein automated matches [191227] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189645] (2 PDB entries) |
Domain d2y8fc_: 2y8f C: [170693] Other proteins in same PDB: d2y8fd2 automated match to d2crfa1 complexed with cl, gol |
PDB Entry: 2y8f (more details), 2.1 Å
SCOPe Domain Sequences for d2y8fc_:
Sequence, based on SEQRES records: (download)
>d2y8fc_ b.55.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esnvlqmqcklfvfdktsqswvergrgllrlndmastddgtlqsrlvmrtqgslrlilnt klwaqmqidkaseksiritamdtedqgvkvflisasskdtgqlyaalhhrilalrsrv
>d2y8fc_ b.55.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esnvlqmqcklfvfdktsqswvergrgllrlndmagtlqsrlvmrtqgslrlilntklwa qmqidkaseksiritamdtedqgvkvflisasskdtgqlyaalhhrilalrsrv
Timeline for d2y8fc_:
View in 3D Domains from other chains: (mouse over for more information) d2y8fa_, d2y8fb_, d2y8fd1, d2y8fd2 |