SCOPe 2.08: Domain d2y6ca1: 2y6c A:100-263

Lineage for d2y6ca1 (2y6c A:100-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d2y6ca1: 2y6c A:100-263 [170650]
   Other proteins in same PDB: d2y6ca2
   automated match to d1mmra_
   complexed with ca, so4, tqi, zn

Details for d2y6ca1

PDB Entry: 2y6c, 1.7 Å

PDB Description: the discovery of mmp7 inhibitors exploiting a novel selectivity trigger

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2y6ca1:

Sequence, based on SEQRES records:

>d2y6ca1 d.92.1.11 (A:100-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqkly

Sequence, based on observed residues (ATOM records):

>d2y6ca1 d.92.1.11 (A:100-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptypqnfklsqddikgiqkly

Timeline for d2y6ca1:

• d2y6ca1 first appeared in SCOPe 2.01, called d2y6ca_
  
• d2y6ca1 appears in SCOPe 2.07