SCOPe 2.04: Domain d2y5ha_: 2y5h A:

Lineage for d2y5ha_ (2y5h A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (136 PDB entries)

8. Domain d2y5ha_: 2y5h A: [170614]
   Other proteins in same PDB: d2y5hl_
   automated match to d2boka1
   complexed with na, y5h

Details for d2y5ha_

PDB Entry: 2y5h, 1.33 Å

PDB Description: factor xa - cation inhibitor complex

PDB Compounds: (A:) activated factor xa heavy chain

SCOPe Domain Sequences for d2y5ha_:

Sequence; same for both SEQRES and ATOM records:

>d2y5ha_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt

Timeline for d2y5ha_:

• d2y5ha_ first appeared in SCOPe 2.01
  
• d2y5ha_ appears in SCOPe 2.03
  
• d2y5ha_ appears in SCOPe 2.05
  
• d2y5ha_ appears in the current release, SCOPe 2.08