Lineage for d2y5fa_ (2y5f A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066187Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2066188Domain d2y5fa_: 2y5f A: [170610]
    Other proteins in same PDB: d2y5fl_
    automated match to d2boka1
    complexed with na, xwg

Details for d2y5fa_

PDB Entry: 2y5f (more details), 1.29 Å

PDB Description: factor xa - cation inhibitor complex
PDB Compounds: (A:) activated factor xa heavy chain

SCOPe Domain Sequences for d2y5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5fa_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt

SCOPe Domain Coordinates for d2y5fa_:

Click to download the PDB-style file with coordinates for d2y5fa_.
(The format of our PDB-style files is described here.)

Timeline for d2y5fa_: