SCOPe 2.05: Domain d2y5ca_: 2y5c A:

Lineage for d2y5ca_ (2y5c A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189894] (1 PDB entry)

8. Domain d2y5ca_: 2y5c A: [170608]
   automated match to d1l6ua_
   complexed with fes, so4

Details for d2y5ca_

PDB Entry: 2y5c, 1.7 Å

PDB Description: Structure of human ferredoxin 2 (Fdx2)in complex with 2Fe2S cluster

PDB Compounds: (A:) adrenodoxin-like protein, mitochondrial

SCOPe Domain Sequences for d2y5ca_:

Sequence; same for both SEQRES and ATOM records:

>d2y5ca_ d.15.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedhld
llpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr

Timeline for d2y5ca_:

• d2y5ca_ first appeared in SCOPe 2.01
  
• d2y5ca_ appears in SCOPe 2.04
  
• d2y5ca_ is called d2y5ca1 in SCOPe 2.06
  
• d2y5ca_ appears in the current release, SCOPe 2.08, called d2y5ca1