Lineage for d2y5aa1 (2y5a A:4-294)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005140Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2005141Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2005148Domain d2y5aa1: 2y5a A:4-294 [170605]
    Other proteins in same PDB: d2y5aa2
    automated match to d1aa4a_
    complexed with 3ap, hem

Details for d2y5aa1

PDB Entry: 2y5a (more details), 1.25 Å

PDB Description: cytochrome c peroxidase (ccp) w191g bound to 3-aminopyridine
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2y5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5aa1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2y5aa1:

Click to download the PDB-style file with coordinates for d2y5aa1.
(The format of our PDB-style files is described here.)

Timeline for d2y5aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2y5aa2