SCOPe 2.02: Domain d2y4pd_: 2y4p D:

Lineage for d2y4pd_ (2y4p D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)

8. Domain d2y4pd_: 2y4p D: [170602]
   automated match to d1ig1a_

Details for d2y4pd_

PDB Entry: 2y4p, 2.65 Å

PDB Description: Dimeric structure of DAPK-1 catalytic domain

PDB Compounds: (D:) Death-associated protein kinase 1

SCOPe Domain Sequences for d2y4pd_:

Sequence, based on SEQRES records:

>d2y4pd_ d.144.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsredierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteee
ateflkqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefk
nifgtpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnye
fedeyfsntsalakdfirrllvkdpkkrmtiqdslqhpwik

Sequence, based on observed residues (ATOM records):

>d2y4pd_ d.144.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsredierevsilkeiqhpnvitlhevlelvaggelfdflaeeeateflkqilngvyylh
slqiahfdlkpenimlldrnvpkprikiidfglahkidpefvapeivnyeplgleadmws
igvityillsgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllvkdpkk
rmtiqdslqhpwik

Timeline for d2y4pd_:

• d2y4pd_ first appeared in SCOPe 2.01
  
• d2y4pd_ appears in SCOPe 2.03
  
• d2y4pd_ appears in the current release, SCOPe 2.08