SCOPe 2.06: Domain d2y41b1: 2y41 B:1-345

Lineage for d2y41b1 (2y41 B:1-345)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (19 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [189081] (6 PDB entries)

8. Domain d2y41b1: 2y41 B:1-345 [170584]
   Other proteins in same PDB: d2y41a2, d2y41a3, d2y41b2, d2y41b3
   automated match to d1g2ua_
   complexed with ipm, mn

Details for d2y41b1

PDB Entry: 2y41, 2.2 Å

PDB Description: structure of isopropylmalate dehydrogenase from thermus thermophilus - complex with ipm and mn

PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d2y41b1:

Sequence; same for both SEQRES and ATOM records:

>d2y41b1 c.77.1.1 (B:1-345) automated matches {Thermus thermophilus [TaxId: 274]}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

Timeline for d2y41b1:

• d2y41b1 first appeared in SCOPe 2.01, called d2y41b_
  
• d2y41b1 was called d2y41b_ in SCOPe 2.05
  
• d2y41b1 appears in SCOPe 2.07
  
• d2y41b1 appears in the current release, SCOPe 2.08