![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
![]() | Species Escherichia coli [TaxId:562] [47245] (11 PDB entries) |
![]() | Domain d2y3qa_: 2y3q A: [170565] automated match to d1bcfa_ complexed with act, btb, hem, so4 |
PDB Entry: 2y3q (more details), 1.55 Å
SCOPe Domain Sequences for d2y3qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y3qa_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqireeg
Timeline for d2y3qa_: