SCOPe 2.08: Domain d2y3nd1: 2y3n D:2-64

Lineage for d2y3nd1 (2y3n D:2-64)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Bacteroides cellulosolvens [TaxId:35825] [189868] (1 PDB entry)

8. Domain d2y3nd1: 2y3n D:2-64 [170564]
   Other proteins in same PDB: d2y3na1, d2y3na2, d2y3na3, d2y3nb2, d2y3nc1, d2y3nc2, d2y3nd2
   automated match to d1ohzb_
   complexed with ca

Details for d2y3nd1

PDB Entry: 2y3n, 1.9 Å

PDB Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens

PDB Compounds: (D:) cellulosomal family-48 processive glycoside hydrolase

SCOPe Domain Sequences for d2y3nd1:

Sequence, based on SEQRES records:

>d2y3nd1 a.139.1.0 (D:2-64) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
fvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyfg
ktk

Sequence, based on observed residues (ATOM records):

>d2y3nd1 a.139.1.0 (D:2-64) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
fvklkgdlngdgvinmadvmilaqsfgkdgvinsddaiilaqyfgktk

Timeline for d2y3nd1:

• d2y3nd1 first appeared in SCOPe 2.01, called d2y3nd_
  
• d2y3nd1 appears in SCOPe 2.07