Class a: All alpha proteins [46456] (290 folds) |
Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) |
Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
Protein automated matches [190928] (7 species) not a true protein |
Species Bacteroides cellulosolvens [TaxId:35825] [189868] (1 PDB entry) |
Domain d2y3nd1: 2y3n D:2-64 [170564] Other proteins in same PDB: d2y3na1, d2y3na2, d2y3na3, d2y3nb2, d2y3nc1, d2y3nc2, d2y3nd2 automated match to d1ohzb_ complexed with ca |
PDB Entry: 2y3n (more details), 1.9 Å
SCOPe Domain Sequences for d2y3nd1:
Sequence, based on SEQRES records: (download)
>d2y3nd1 a.139.1.0 (D:2-64) automated matches {Bacteroides cellulosolvens [TaxId: 35825]} fvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyfg ktk
>d2y3nd1 a.139.1.0 (D:2-64) automated matches {Bacteroides cellulosolvens [TaxId: 35825]} fvklkgdlngdgvinmadvmilaqsfgkdgvinsddaiilaqyfgktk
Timeline for d2y3nd1: