Lineage for d2xyvb_ (2xyv B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067830Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 1067831Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
  5. 1067832Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. 1067884Protein automated matches [191249] (1 species)
    not a true protein
  7. 1067885Species SARS coronavirus [TaxId:227859] [189770] (3 PDB entries)
  8. 1067887Domain d2xyvb_: 2xyv B: [170489]
    automated match to d2g9ta1
    complexed with cl, mg, na, sah, zn

Details for d2xyvb_

PDB Entry: 2xyv (more details), 2.06 Å

PDB Description: crystal structure of the nsp16 nsp10 sars coronavirus complex
PDB Compounds: (B:) non-structural protein 10

SCOPe Domain Sequences for d2xyvb_:

Sequence, based on SEQRES records: (download)

>d2xyvb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
stvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgg
ascclycrchidhpnpkgfcdlkgkfvqipttcandpvgftlrntvctvcgmwkgygcs

Sequence, based on observed residues (ATOM records): (download)

>d2xyvb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
stvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgg
ascclycrchidhpncdlkgkfvqipttcandpvgftlrntvctvcgmwkgygcs

SCOPe Domain Coordinates for d2xyvb_:

Click to download the PDB-style file with coordinates for d2xyvb_.
(The format of our PDB-style files is described here.)

Timeline for d2xyvb_: