SCOPe 2.08: Domain d2xyqb_: 2xyq B:

Lineage for d2xyqb_ (2xyq B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
   binds two zinc ion per subunit; forms a dodecameric shell

4. Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family)
   automatically mapped to Pfam PF09401

5. Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
   partly covered by PfamB PB001266

6. Protein automated matches [191249] (3 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [189770] (4 PDB entries)

8. Domain d2xyqb_: 2xyq B: [170487]
   Other proteins in same PDB: d2xyqa_
   automated match to d2g9ta1
   complexed with cl, mg, na, sah, zn

Details for d2xyqb_

PDB Entry: 2xyq, 2 Å

PDB Description: crystal structure of the nsp16 nsp10 sars coronavirus complex

PDB Compounds: (B:) non-structural protein 10

SCOPe Domain Sequences for d2xyqb_:

Sequence; same for both SEQRES and ATOM records:

>d2xyqb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
cd

Timeline for d2xyqb_:

• d2xyqb_ first appeared in SCOPe 2.01
  
• d2xyqb_ appears in SCOPe 2.07