SCOPe 2.03: Domain d2xykb_: 2xyk B:

Lineage for d2xykb_ (2xyk B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (11 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:358] [189552] (1 PDB entry)

8. Domain d2xykb_: 2xyk B: [170485]
   automated match to d1ux8a_
   complexed with hem

Details for d2xykb_

PDB Entry: 2xyk, 2.1 Å

PDB Description: Group II 2-on-2 Hemoglobin from the Plant Pathogen Agrobacterium tumefaciens

PDB Compounds: (B:) 2-on-2 hemoglobin

SCOPe Domain Sequences for d2xykb_:

Sequence; same for both SEQRES and ATOM records:

>d2xykb_ a.1.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy
lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver
lafhmqnqea

Timeline for d2xykb_:

• d2xykb_ first appeared in SCOPe 2.01
  
• d2xykb_ appears in SCOPe 2.02
  
• d2xykb_ appears in SCOPe 2.04
  
• d2xykb_ appears in the current release, SCOPe 2.08