SCOPe 2.08: Domain d2xxmb1: 2xxm B:4-112

Lineage for d2xxmb1 (2xxm B:4-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d2xxmb1: 2xxm B:4-112 [170472]
   Other proteins in same PDB: d2xxmb2
   automated match to d2p42b1
   complexed with act

Details for d2xxmb1

PDB Entry: 2xxm, 1.65 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.

PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xxmb1:

Sequence; same for both SEQRES and ATOM records:

>d2xxmb1 b.1.1.1 (B:4-112) automated matches {Vicugna pacos [TaxId: 30538]}
lvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvydds
vkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvs

Timeline for d2xxmb1:

• d2xxmb1 first appeared in SCOPe 2.01, called d2xxmb_
  
• d2xxmb1 appears in SCOPe 2.07