SCOPe 2.01: Domain d2xxcb_: 2xxc B:

Lineage for d2xxcb_ (2xxc B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (4 PDB entries)

8. Domain d2xxcb_: 2xxc B: [170464]
   automated match to d2p42b1

Details for d2xxcb_

PDB Entry: 2xxc, 1.67 Å

PDB Description: crystal structure of a camelid vhh raised against the hiv-1 capsid protein c-terminal domain.

PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xxcb_:

Sequence; same for both SEQRES and ATOM records:

>d2xxcb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss

Timeline for d2xxcb_:

• d2xxcb_ is new in SCOPe 2.01-stable
  
• d2xxcb_ appears in SCOPe 2.02
  
• d2xxcb_ appears in the current release, SCOPe 2.08, called d2xxcb1