Lineage for d2xvna_ (2xvn A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971534Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 971535Protein automated matches [190075] (16 species)
    not a true protein
  7. 971550Species Aspergillus fumigatus [TaxId:5085] [189545] (2 PDB entries)
  8. 971554Domain d2xvna_: 2xvn A: [170425]
    automated match to d1hvqa_
    complexed with cl, kls

Details for d2xvna_

PDB Entry: 2xvn (more details), 2.35 Å

PDB Description: a. fumigatus chitinase a1 phenyl-methylguanylurea complex
PDB Compounds: (A:) aspergillus fumigatus chitinase a1

SCOPe Domain Sequences for d2xvna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvna_ c.1.8.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
dhmkdillh

SCOPe Domain Coordinates for d2xvna_:

Click to download the PDB-style file with coordinates for d2xvna_.
(The format of our PDB-style files is described here.)

Timeline for d2xvna_: