Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.44: TehB-like [142603] (2 proteins) Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724) |
Protein automated matches [191226] (3 species) not a true protein |
Species Escherichia coli [TaxId:511145] [189644] (1 PDB entry) |
Domain d2xvaa1: 2xva A:1-197 [170419] Other proteins in same PDB: d2xvaa2, d2xvab2 automated match to d2i6ga1 complexed with sfg, zn |
PDB Entry: 2xva (more details), 1.9 Å
SCOPe Domain Sequences for d2xvaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvaa1 c.66.1.44 (A:1-197) automated matches {Escherichia coli [TaxId: 511145]} mvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdk namsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglianm qrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtda ngnriklrfatmlarkk
Timeline for d2xvaa1:
View in 3D Domains from other chains: (mouse over for more information) d2xvab1, d2xvab2, d2xvac_, d2xvad_ |