SCOPe 2.01: Domain d2xuma_: 2xum A:

Lineage for d2xuma_ (2xum A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins)

6. Protein automated matches [190145] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186870] (13 PDB entries)

8. Domain d2xuma_: 2xum A: [170406]
   automated match to d1iz3a_
   complexed with oga, so4, zn; mutant

Details for d2xuma_

PDB Entry: 2xum, 2.2 Å

PDB Description: factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)

PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d2xuma_:

Sequence; same for both SEQRES and ATOM records:

>d2xuma_ b.82.2.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrhs
qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d2xuma_:

• d2xuma_ is new in SCOPe 2.01-stable
  
• d2xuma_ appears in SCOPe 2.02
  
• d2xuma_ appears in the current release, SCOPe 2.08