SCOPe 2.02: Domain d2xuca_: 2xuc A:

Lineage for d2xuca_ (2xuc A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (30 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:5085] [189545] (2 PDB entries)

8. Domain d2xuca_: 2xuc A: [170383]
   automated match to d1hvqa_
   complexed with cl, po4, xrg

Details for d2xuca_

PDB Entry: 2xuc, 2.3 Å

PDB Description: natural product-guided discovery of a fungal chitinase inhibitor

PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d2xuca_:

Sequence; same for both SEQRES and ATOM records:

>d2xuca_ c.1.8.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
adhmkdillh

Timeline for d2xuca_:

• d2xuca_ first appeared in SCOPe 2.01
  
• d2xuca_ appears in SCOPe 2.03
  
• d2xuca_ appears in the current release, SCOPe 2.08, called d2xuca1