Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (4 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries) |
Domain d2xson_: 2xso N: [170370] Other proteins in same PDB: d2xsoa1, d2xsoa2, d2xsoc1, d2xsoc2, d2xsoe1, d2xsoe2, d2xsog1, d2xsog2, d2xsoi1, d2xsoi2, d2xsok1, d2xsok2, d2xsom1, d2xsom2, d2xsoo1, d2xsoo2, d2xsoq1, d2xsoq2, d2xsos1, d2xsos2, d2xsou1, d2xsou2, d2xsow1, d2xsow2 automated match to d1wqlb1 complexed with fe2, fes |
PDB Entry: 2xso (more details), 2.2 Å
SCOPe Domain Sequences for d2xson_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xson_ d.17.4.4 (N:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf f
Timeline for d2xson_:
View in 3D Domains from other chains: (mouse over for more information) d2xsoa1, d2xsoa2, d2xsob_, d2xsoc1, d2xsoc2, d2xsod_, d2xsoe1, d2xsoe2, d2xsof_, d2xsog1, d2xsog2, d2xsoh_, d2xsoi1, d2xsoi2, d2xsoj_, d2xsok1, d2xsok2, d2xsol_, d2xsom1, d2xsom2, d2xsoo1, d2xsoo2, d2xsop_, d2xsoq1, d2xsoq2, d2xsor_, d2xsos1, d2xsos2, d2xsot_, d2xsou1, d2xsou2, d2xsov_, d2xsow1, d2xsow2, d2xsox_ |