SCOPe 2.08: Domain d2r63a_: 2r63 A:

Lineage for d2r63a_ (2r63 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d2r63a_: 2r63 A: [17036]

Details for d2r63a_

PDB Entry: 2r63

PDB Description: structural role of a buried salt bridge in the 434 repressor dna- binding domain, nmr, 20 structures

PDB Compounds: (A:) repressor protein from bacteriophage 434

SCOPe Domain Sequences for d2r63a_:

Sequence; same for both SEQRES and ATOM records:

>d2r63a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskmiqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

Timeline for d2r63a_:

• d2r63a_ first appeared (with stable ids) in SCOP 1.55, called d2r63__
  
• d2r63a_ appears in SCOPe 2.07