Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (4 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries) |
Domain d2xrxf_: 2xrx F: [170337] Other proteins in same PDB: d2xrxa1, d2xrxa2, d2xrxc1, d2xrxc2, d2xrxe1, d2xrxe2, d2xrxg1, d2xrxg2, d2xrxi1, d2xrxi2, d2xrxk1, d2xrxk2, d2xrxm1, d2xrxm2, d2xrxo1, d2xrxo2, d2xrxq1, d2xrxq2, d2xrxs1, d2xrxs2, d2xrxu1, d2xrxu2, d2xrxw1, d2xrxw2 automated match to d1wqlb1 complexed with bnl, fe2, fes |
PDB Entry: 2xrx (more details), 2.42 Å
SCOPe Domain Sequences for d2xrxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xrxf_ d.17.4.4 (F:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf f
Timeline for d2xrxf_:
View in 3D Domains from other chains: (mouse over for more information) d2xrxa1, d2xrxa2, d2xrxb_, d2xrxc1, d2xrxc2, d2xrxd_, d2xrxe1, d2xrxe2, d2xrxg1, d2xrxg2, d2xrxh_, d2xrxi1, d2xrxi2, d2xrxj_, d2xrxk1, d2xrxk2, d2xrxl_, d2xrxm1, d2xrxm2, d2xrxn_, d2xrxo1, d2xrxo2, d2xrxp_, d2xrxq1, d2xrxq2, d2xrxr_, d2xrxs1, d2xrxs2, d2xrxt_, d2xrxu1, d2xrxu2, d2xrxv_, d2xrxw1, d2xrxw2, d2xrxx_ |