SCOPe 2.06: Domain d2or1r_: 2or1 R:

Lineage for d2or1r_ (2or1 R:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d2or1r_: 2or1 R: [17032]
   protein/DNA complex

Details for d2or1r_

PDB Entry: 2or1, 2.5 Å

PDB Description: recognition of a dna operator by the repressor of phage 434. a view at high resolution

PDB Compounds: (R:) 434 repressor

SCOPe Domain Sequences for d2or1r_:

Sequence; same for both SEQRES and ATOM records:

>d2or1r_ a.35.1.2 (R:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

Timeline for d2or1r_:

• d2or1r_ first appeared (with stable ids) in SCOP 1.55
  
• d2or1r_ appears in SCOPe 2.05
  
• d2or1r_ appears in SCOPe 2.07
  
• d2or1r_ appears in the current release, SCOPe 2.08