![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries) |
![]() | Domain d2xr8v_: 2xr8 V: [170314] Other proteins in same PDB: d2xr8a1, d2xr8a2, d2xr8c1, d2xr8c2, d2xr8e1, d2xr8e2, d2xr8g1, d2xr8g2, d2xr8i1, d2xr8i2, d2xr8k1, d2xr8k2, d2xr8m1, d2xr8m2, d2xr8o1, d2xr8o2, d2xr8q1, d2xr8q2, d2xr8s1, d2xr8s2, d2xr8u1, d2xr8u2, d2xr8w1, d2xr8w2 automated match to d1wqlb1 complexed with fe2, fes |
PDB Entry: 2xr8 (more details), 2.49 Å
SCOPe Domain Sequences for d2xr8v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xr8v_ d.17.4.4 (V:) automated matches {Burkholderia xenovorans [TaxId: 266265]} fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2xr8v_:
![]() Domains from other chains: (mouse over for more information) d2xr8a1, d2xr8a2, d2xr8b_, d2xr8c1, d2xr8c2, d2xr8d_, d2xr8e1, d2xr8e2, d2xr8f_, d2xr8g1, d2xr8g2, d2xr8h_, d2xr8i1, d2xr8i2, d2xr8j_, d2xr8k1, d2xr8k2, d2xr8l_, d2xr8m1, d2xr8m2, d2xr8n_, d2xr8o1, d2xr8o2, d2xr8p_, d2xr8q1, d2xr8q2, d2xr8r_, d2xr8s1, d2xr8s2, d2xr8t_, d2xr8u1, d2xr8u2, d2xr8w1, d2xr8w2, d2xr8x_ |