Lineage for d2xqwa1 (2xqw A:3-294)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007408Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2007681Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2007685Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2007686Species Human (Homo sapiens) [TaxId:9606] [48253] (17 PDB entries)
  8. 2007700Domain d2xqwa1: 2xqw A:3-294 [170300]
    Other proteins in same PDB: d2xqwa2, d2xqwb2
    automated match to d1c3da_

Details for d2xqwa1

PDB Entry: 2xqw (more details), 2.3 Å

PDB Description: structure of factor h domains 19-20 in complex with complement c3d
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d2xqwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqwa1 a.102.4.4 (A:3-294) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d2xqwa1:

Click to download the PDB-style file with coordinates for d2xqwa1.
(The format of our PDB-style files is described here.)

Timeline for d2xqwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xqwa2